CPB2 Polyclonal AntibodyCPB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CPB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13661-200ul 200ul
£332.50
A13661-100ul 100ul
£192.50
A13661-50ul 50ul
£113.75
A13661-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13661
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CPB2; CPU; PCPB; TAFI; carboxypeptidase B2
Applications IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-365 of human CPB2 (NP_001863.2).
Reactivity Human, Mouse
Gene ID 1361
Calculated MW 40kDa/48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ASASYYEQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQFYGIIGQYTNLLRLVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCGLYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLA
Sensitivity IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents