CORO1C Polyclonal AntibodyCORO1C Polyclonal Antibody
Move your mouse over image or click to enlarge

CORO1C Polyclonal Antibody

Cat# Size Price Qty Buy
A4568-200ul 200ul
£332.50
A4568-100ul 100ul
£192.50
A4568-50ul 50ul
£113.75
A4568-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4568
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CORO1C; HCRNN4; coronin-1C
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 375-474 of human CORO1C (NP_055140.1).
Reactivity Human
Gene ID 23603
Calculated MW 53kDa/54kDa/58kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents