CORO1B Polyclonal AntibodyCORO1B Polyclonal Antibody
Move your mouse over image or click to enlarge

CORO1B Polyclonal Antibody

Cat# Size Price Qty Buy
A14593-200ul 200ul
£332.50
A14593-100ul 100ul
£192.50
A14593-50ul 50ul
£113.75
A14593-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14593
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CORO1B; CORONIN-2; coronin-1B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 380-489 of human CORO1B (NP_065174.1).
Reactivity Rat
Gene ID 57175
Calculated MW 54kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents