COG8 Polyclonal AntibodyCOG8 Polyclonal Antibody
Move your mouse over image or click to enlarge

COG8 Polyclonal Antibody

Cat# Size Price Qty Buy
A14361-200ul 200ul
£332.50
A14361-100ul 100ul
£192.50
A14361-50ul 50ul
£113.75
A14361-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14361
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names COG8; CDG2H; DOR1; component of oligomeric golgi complex 8
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 394-612 of human COG8 (NP_115758.3).
Reactivity Human
Gene ID 84342
Calculated MW 68kDa
Observed MW 68kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents