CNGA3 Polyclonal AntibodyCNGA3 Polyclonal Antibody
Move your mouse over image or click to enlarge

CNGA3 Polyclonal Antibody

Cat# Size Price Qty Buy
A3288-200ul 200ul
£332.50
A3288-100ul 100ul
£192.50
A3288-50ul 50ul
£113.75
A3288-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3288
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CNGA3; ACHM2; CCNC1; CCNCa; CCNCalpha; CNCG3; CNG3; cyclic nucleotide gated channel alpha 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1).
Reactivity Human, Mouse, Rat
Gene ID 1261
Calculated MW 76-79kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents