CLTA Polyclonal AntibodyCLTA Polyclonal Antibody
Move your mouse over image or click to enlarge

CLTA Polyclonal Antibody

Cat# Size Price Qty Buy
A3793-200ul 200ul
£332.50
A3793-100ul 100ul
£192.50
A3793-50ul 50ul
£113.75
A3793-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3793
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLTA; LCA; clathrin light chain A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of human CLTA (NP_001824.1).
Reactivity Human, Mouse, Rat
Gene ID 1211
Calculated MW 17kDa/23kDa/24kDa/25kDa/27kDa
Observed MW 33kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30642589
Sequence MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents