CLNS1A Polyclonal AntibodyCLNS1A Polyclonal Antibody
Move your mouse over image or click to enlarge

CLNS1A Polyclonal Antibody

Cat# Size Price Qty Buy
A16040-20ul 20ul
£77.00
A16040-50ul 50ul
£113.75
A16040-100ul 100ul
£192.50
A16040-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16040
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLNS1A; CLCI; CLNS1B; ICln; methylosome subunit pICln
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1).
Reactivity Human, Mouse, Rat
Gene ID 1207
Calculated MW 26kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents