CLK1 Polyclonal AntibodyCLK1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CLK1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13653-200ul 200ul
£332.50
A13653-100ul 100ul
£192.50
A13653-50ul 50ul
£113.75
A13653-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13653
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLK1; CLK; CLK/STY; STY; CDC like kinase 1
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CLK1 (NP_004062.2).
Reactivity Human
Gene ID 1195
Calculated MW 16kDa/57kDa/61kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHG
Sensitivity IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents