CLEC4M Polyclonal AntibodyCLEC4M Polyclonal Antibody
Move your mouse over image or click to enlarge

CLEC4M Polyclonal Antibody

Cat# Size Price Qty Buy
A14268-200ul 200ul
£332.50
A14268-100ul 100ul
£192.50
A14268-50ul 50ul
£113.75
A14268-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14268
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLEC4M; CD209L; CD299; DC-SIGN2; DC-SIGNR; DCSIGNR; HP10347; L-SIGN; LSIGN; C-type lectin domain family 4 member M
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 280-399 of human CLEC4M (NP_055072.3).
Reactivity Human, Mouse, Rat
Gene ID 10332
Calculated MW 24-45kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents