CLEC11A Polyclonal AntibodyCLEC11A Polyclonal Antibody
Move your mouse over image or click to enlarge

CLEC11A Polyclonal Antibody

Cat# Size Price Qty Buy
A3634-200ul 200ul
£332.50
A3634-100ul 100ul
£192.50
A3634-50ul 50ul
£113.75
A3634-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3634
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLEC11A; CLECSF3; LSLCL; P47; SCGF; C-type lectin domain containing 11A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-323 of human CLEC11A (NP_002966.1).
Reactivity Human, Mouse
Gene ID 6320
Calculated MW 35kDa
Observed MW 46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents