CLDN8 Polyclonal AntibodyCLDN8 Polyclonal Antibody
Move your mouse over image or click to enlarge

CLDN8 Polyclonal Antibody

Cat# Size Price Qty Buy
A14470-200ul 200ul
£332.50
A14470-100ul 100ul
£192.50
A14470-50ul 50ul
£113.75
A14470-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14470
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLDN8; HEL-S-79; claudin-8
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-81 of human CLDN8 (NP_955360.1).
Reactivity Mouse
Gene ID 9073
Calculated MW 24kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence QWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAAR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents