CLCN4 Polyclonal AntibodyCLCN4 Polyclonal Antibody
Move your mouse over image or click to enlarge

CLCN4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13790-200ul 200ul
£332.50
A13790-100ul 100ul
£192.50
A13790-50ul 50ul
£113.75
A13790-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13790
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLCN4; CLC4; ClC-4; ClC-4A; MRX15; MRX49; chloride voltage-gated channel 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human CLCN4 (NP_001821.2).
Reactivity Human, Mouse, Rat
Gene ID 1183
Calculated MW 74kDa/84kDa
Observed MW 85kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRPRRGEPPLSVLTQDSMTVEDVETLIKETDYNGFPVVVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents