CKS2 Polyclonal AntibodyCKS2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CKS2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3791-200ul 200ul
£332.50
A3791-100ul 100ul
£192.50
A3791-50ul 50ul
£113.75
A3791-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3791
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CKS2; CKSHS2; CDC28 protein kinase regulatory subunit 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human CKS2 (NP_001818.1).
Reactivity Mouse, Rat
Gene ID 1164
Calculated MW 9kDa
Observed MW 14kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents