CKMT1B Polyclonal AntibodyCKMT1B Polyclonal Antibody
Move your mouse over image or click to enlarge

CKMT1B Polyclonal Antibody

Cat# Size Price Qty Buy
A3046-200ul 200ul
£332.50
A3046-100ul 100ul
£192.50
A3046-50ul 50ul
£113.75
A3046-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3046
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CKMT1B; CKMT; CKMT1; UMTCK; creatine kinase, mitochondrial 1B
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1).
Reactivity Human, Mouse, Rat
Gene ID 1159
Calculated MW 47kDa/50kDa
Observed MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents