CISD2 Polyclonal AntibodyCISD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CISD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14168-200ul 200ul
£332.50
A14168-100ul 100ul
£192.50
A14168-50ul 50ul
£113.75
A14168-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14168
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CISD2; ERIS; Miner1; NAF-1; WFS2; ZCD2; CDGSH iron sulfur domain 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 61-135 of human CISD2 (NP_001008389.1).
Reactivity Human, Mouse, Rat
Gene ID 493856
Calculated MW 15kDa
Observed MW 15kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents