CHST10 Polyclonal AntibodyCHST10 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHST10 Polyclonal Antibody

Cat# Size Price Qty Buy
A4307-200ul 200ul
£332.50
A4307-100ul 100ul
£192.50
A4307-50ul 50ul
£113.75
A4307-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4307
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHST10; HNK-1ST; HNK1ST; carbohydrate sulfotransferase 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-250 of human CHST10 (NP_004845.1).
Reactivity Human
Gene ID 9486
Calculated MW 42kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents