CHRNA6 Polyclonal AntibodyCHRNA6 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHRNA6 Polyclonal Antibody

Cat# Size Price Qty Buy
A14081-200ul 200ul
£332.50
A14081-100ul 100ul
£192.50
A14081-50ul 50ul
£113.75
A14081-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14081
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHRNA6; CHNRA6; cholinergic receptor nicotinic alpha 6 subunit
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-440 of human CHRNA6 (NP_004189.1).
Reactivity Human, Rat
Gene ID 8973
Calculated MW 55kDa/56kDa
Observed MW 57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents