CHRNA1 Polyclonal AntibodyCHRNA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHRNA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13287-200ul 200ul
£332.50
A13287-100ul 100ul
£192.50
A13287-50ul 50ul
£113.75
A13287-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13287
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHRNA1; ACHRA; ACHRD; CHRNA; CMS1A; CMS1B; CMS2A; FCCMS; SCCMS; acetylcholine receptor subunit alpha
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 105-220 of human CHRNA1 (NP_000070.1).
Reactivity Human
Gene ID 1134
Calculated MW 51kDa/54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLD
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents