CHIA Polyclonal AntibodyCHIA Polyclonal Antibody
Move your mouse over image or click to enlarge

CHIA Polyclonal Antibody

Cat# Size Price Qty Buy
A3416-200ul 200ul
£332.50
A3416-100ul 100ul
£192.50
A3416-50ul 50ul
£113.75
A3416-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3416
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHIA; AMCASE; CHIT2; TSA1902; chitinase, acidic
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CHIA (NP_001244932.1).
Reactivity Human, Mouse, Rat
Gene ID 27159
Calculated MW 33kDa/40kDa/52kDa
Observed MW 52kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents