CHD2 Polyclonal AntibodyCHD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13478-200ul 200ul
£332.50
A13478-100ul 100ul
£192.50
A13478-50ul 50ul
£113.75
A13478-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13478
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHD2; EEOC; chromodomain-helicase-DNA-binding protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1700 to the C-terminus of human CHD2 (NP_001262.3).
Reactivity Human
Gene ID 1106
Calculated MW 56kDa/200kDa/211kDa
Observed MW 270kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMSDHRPAMGYHGQGPSDHYRSFHTDKLGEYKQPLPPLHPAVSDPRSPPSQKSPHDSKSPLDHRSPLERSLEQKNNPDYNWNVRKT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents