CHCHD4 Polyclonal AntibodyCHCHD4 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHCHD4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13139-200ul 200ul
£332.50
A13139-100ul 100ul
£192.50
A13139-50ul 50ul
£113.75
A13139-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13139
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHCHD4; MIA40; TIMM40; coiled-coil-helix-coiled-coil-helix domain containing 4
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human CHCHD4 (NP_001091972.1).
Reactivity Human, Mouse, Rat
Gene ID 131474
Calculated MW 15kDa/17kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents