CHCHD1 Polyclonal AntibodyCHCHD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHCHD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15941-20ul 20ul
£77.00
A15941-50ul 50ul
£113.75
A15941-100ul 100ul
£192.50
A15941-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15941
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHCHD1; C10orf34; C2360; MRP-S37; coiled-coil-helix-coiled-coil-helix domain containing 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human CHCHD1 (NP_976043.1).
Reactivity Human, Mouse
Gene ID 118487
Calculated MW 13kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents