CGGBP1 Polyclonal AntibodyCGGBP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CGGBP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4231-200ul 200ul
£332.50
A4231-100ul 100ul
£192.50
A4231-50ul 50ul
£113.75
A4231-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4231
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CGGBP1; CGGBP; p20-CGGBP; CGG triplet repeat-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CGGBP1 (NP_003654.3).
Reactivity Human
Gene ID 8545
Calculated MW 18kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents