CFH Polyclonal AntibodyCFH Polyclonal Antibody
Move your mouse over image or click to enlarge

CFH Polyclonal Antibody

Cat# Size Price Qty Buy
A13686-200ul 200ul
£332.50
A13686-100ul 100ul
£192.50
A13686-50ul 50ul
£113.75
A13686-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13686
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CFH; AHUS1; AMBP1; ARMD4; ARMS1; CFHL3; FH; FHL1; HF; HF1; HF2; HUS; complement factor H
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-445 of human CFH (NP_001014975.1).
Reactivity Human
Gene ID 3075
Calculated MW 51kDa/139kDa
Observed MW 139kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents