CFAP44 Polyclonal AntibodyCFAP44 Polyclonal Antibody
Move your mouse over image or click to enlarge

CFAP44 Polyclonal Antibody

Cat# Size Price Qty Buy
A14539-200ul 200ul
£332.50
A14539-100ul 100ul
£192.50
A14539-50ul 50ul
£113.75
A14539-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14539
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CFAP44; WDR52; cilia and flagella associated protein 44
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-370 of human CFAP44 (NP_001157968.1).
Reactivity Human, Mouse
Gene ID 55779
Calculated MW 111kDa/213kDa
Observed MW 112kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SSSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKGYAYVDFNYSGNLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEGGLIKVELCRGTSKSCHNGPI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents