CERKL Polyclonal AntibodyCERKL Polyclonal Antibody
Move your mouse over image or click to enlarge

CERKL Polyclonal Antibody

Cat# Size Price Qty Buy
A15984-20ul 20ul
£77.00
A15984-50ul 50ul
£113.75
A15984-100ul 100ul
£192.50
A15984-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15984
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CERKL; RP26; ceramide kinase like
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 359-558 of human CERKL (NP_001025482.1).
Reactivity Mouse
Gene ID 375298
Calculated MW 19kDa, 24kDa, 42-62kDa
Observed MW 63kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNSSDDVQERRAQGSPKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMIPK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents