CERCAM Polyclonal AntibodyCERCAM Polyclonal Antibody
Move your mouse over image or click to enlarge

CERCAM Polyclonal Antibody

Cat# Size Price Qty Buy
A14359-200ul 200ul
£332.50
A14359-100ul 100ul
£192.50
A14359-50ul 50ul
£113.75
A14359-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14359
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CERCAM; CEECAM1; GLT25D3; cerebral endothelial cell adhesion molecule
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 466-595 of human CERCAM (NP_057258.3).
Reactivity Human
Gene ID 51148
Calculated MW 59kDa/67kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VVAGYSYWTLAYALRLAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDDSGRLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents