CEP27 Polyclonal AntibodyCEP27 Polyclonal Antibody
Move your mouse over image or click to enlarge

CEP27 Polyclonal Antibody

Cat# Size Price Qty Buy
A13707-200ul 200ul
£332.50
A13707-100ul 100ul
£192.50
A13707-50ul 50ul
£113.75
A13707-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13707
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HAUS2; C15orf25; CEP27; HsT17025; HAUS augmin-like complex subunit 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-235 of human CEP27 (NP_060567.1).
Reactivity Human
Gene ID 55142
Calculated MW 16kDa/23kDa/26kDa
Observed MW 27kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents