CENPA Polyclonal AntibodyCENPA Polyclonal Antibody
Move your mouse over image or click to enlarge

CENPA Polyclonal Antibody

Cat# Size Price Qty Buy
A15995-20ul 20ul
£77.00
A15995-50ul 50ul
£113.75
A15995-100ul 100ul
£192.50
A15995-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15995
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CENPA; CENP-A; CenH3; centromere protein A
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1).
Reactivity Human
Gene ID 1058
Calculated MW 13kDa/15kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents