CDS2 Polyclonal AntibodyCDS2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CDS2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16080-20ul 20ul
£77.00
A16080-50ul 50ul
£113.75
A16080-100ul 100ul
£192.50
A16080-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16080
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CDS2; CDP-diacylglycerol synthase 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDS2 (NP_003809.1).
Reactivity Human, Mouse
Gene ID 8760
Calculated MW 29kDa/51kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMC
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents