CDKN1B Polyclonal AntibodyCDKN1B Polyclonal Antibody
Move your mouse over image or click to enlarge

CDKN1B Polyclonal Antibody

Cat# Size Price Qty Buy
A13613-200ul 200ul
£332.50
A13613-100ul 100ul
£192.50
A13613-50ul 50ul
£113.75
A13613-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13613
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CDKN1B; CDKN4; KIP1; MEN1B; MEN4; P27KIP1; cyclin-dependent kinase inhibitor 1B
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human CDKN1B (NP_004055.1).
Reactivity Human, Mouse, Rat
Gene ID 1027
Calculated MW 22kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Sensitivity WB,1:500 - 1:1000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents