CDK2AP1 Polyclonal AntibodyCDK2AP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CDK2AP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4203-200ul 200ul
£332.50
A4203-100ul 100ul
£192.50
A4203-50ul 50ul
£113.75
A4203-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4203
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CDK2AP1; DOC1; DORC1; ST19; doc-1; p12DOC-1; cyclin-dependent kinase 2-associated protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1).
Reactivity Human
Gene ID 8099
Calculated MW 9kDa/12kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents