CDK15 Polyclonal AntibodyCDK15 Polyclonal Antibody
Move your mouse over image or click to enlarge

CDK15 Polyclonal Antibody

Cat# Size Price Qty Buy
A13163-200ul 200ul
£332.50
A13163-100ul 100ul
£192.50
A13163-50ul 50ul
£113.75
A13163-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13163
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CDK15; ALS2CR7; PFTAIRE2; PFTK2; cyclin-dependent kinase 15
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 271-400 of human CDK15 (NP_001248365.1).
Reactivity Mouse, Rat
Gene ID 65061
Calculated MW 40kDa/43kDa/45kDa/48kDa/49kDa
Observed MW 49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LLGATEYSSELDIWGAGCIFIEMFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents