CD99L2 Polyclonal AntibodyCD99L2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD99L2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15907-20ul 20ul
£77.00
A15907-50ul 50ul
£113.75
A15907-100ul 100ul
£192.50
A15907-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15907
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD99L2; CD99B; MIC2L1; CD99 molecule like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-185 of human CD99L2 (NP_113650.2).
Reactivity Human, Mouse, Rat
Gene ID 83692
Calculated MW 15kDa/20kDa/22kDa/27kDa/28kDa
Observed MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents