CD8B Polyclonal AntibodyCD8B Polyclonal Antibody
Move your mouse over image or click to enlarge

CD8B Polyclonal Antibody

Cat# Size Price Qty Buy
A3286-200ul 200ul
£332.50
A3286-100ul 100ul
£192.50
A3286-50ul 50ul
£113.75
A3286-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3286
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD8B; CD8B1; LEU2; LY3; LYT3; P37; CD8b molecule
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-170 of human CD8B (NP_757362.1).
Reactivity Human, Mouse, Rat
Gene ID 926
Calculated MW 20kDa/22kDa/23kDa/24kDa/25kDa/27kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents