CD80 Polyclonal AntibodyCD80 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD80 Polyclonal Antibody

Cat# Size Price Qty Buy
A16039-20ul 20ul
£77.00
A16039-50ul 50ul
£113.75
A16039-100ul 100ul
£192.50
A16039-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16039
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD80; B7; B7-1; B7.1; BB1; CD28LG; CD28LG1; LAB7; CD80 molecule
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1).
Reactivity Human, Mouse
Gene ID 941
Calculated MW 18kDa/29kDa/33kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents