CD74 Polyclonal AntibodyCD74 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD74 Polyclonal Antibody

Cat# Size Price Qty Buy
A13958-200ul 200ul
£332.50
A13958-100ul 100ul
£192.50
A13958-50ul 50ul
£113.75
A13958-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13958
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD74; DHLAG; HLADG; II; Ia-GAMMA; CD74 molecule
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 73-232 of human CD74 (NP_004346.1).
Reactivity Human, Mouse
Gene ID 972
Calculated MW 18kDa/26kDa/33kDa
Observed MW 30-40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents