CD68 Polyclonal AntibodyCD68 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD68 Polyclonal Antibody

Cat# Size Price Qty Buy
A13286-200ul 200ul
£332.50
A13286-100ul 100ul
£192.50
A13286-50ul 50ul
£113.75
A13286-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13286
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD68; GP110; LAMP4; SCARD1; macrosialin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-319 of human CD68 (NP_001242.2).
Reactivity Mouse, Rat
Gene ID 968
Calculated MW 31kDa/34kDa/37kDa
Observed MW 85kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents