CD3EAP Polyclonal AntibodyCD3EAP Polyclonal Antibody
Move your mouse over image or click to enlarge

CD3EAP Polyclonal Antibody

Cat# Size Price Qty Buy
A16099-20ul 20ul
£77.00
A16099-50ul 50ul
£113.75
A16099-100ul 100ul
£192.50
A16099-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16099
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD3EAP; ASE-1; ASE1; CAST; PAF49; CD3e molecule associated protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human CD3EAP (NP_036231.1).
Reactivity Human, Mouse
Gene ID 10849
Calculated MW 54kDa/55kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPRSALAPNLL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents