CCNB2 Polyclonal AntibodyCCNB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CCNB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3351-200ul 200ul
£332.50
A3351-100ul 100ul
£192.50
A3351-50ul 50ul
£113.75
A3351-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3351
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CCNB2; HsT17299; cyclin B2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CCNB2 (NP_004692.1).
Reactivity Human, Mouse, Rat
Gene ID 9133
Calculated MW 45kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 29032312|29218001
Sequence MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSM
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents