CCNA1 Polyclonal AntibodyCCNA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CCNA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14529-200ul 200ul
£332.50
A14529-100ul 100ul
£192.50
A14529-50ul 50ul
£113.75
A14529-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14529
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CCNA1; CT146; cyclin-A1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human CCNA1 (NP_001104515.1).
Reactivity Human, Mouse, Rat
Gene ID 8900
Calculated MW 47kDa/52kDa
Observed MW 52kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents