BGN Polyclonal AntibodyBGN Polyclonal Antibody
Move your mouse over image or click to enlarge

BGN Polyclonal Antibody

Cat# Size Price Qty Buy
A3137-200ul 200ul
£332.50
A3137-100ul 100ul
£192.50
A3137-50ul 50ul
£113.75
A3137-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3137
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BGN; DSPG1; MRLS; PG-S1; PGI; SEMDX; SLRR1A; biglycan
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-230 of human BGN (NP_001702.1).
Reactivity Human
Gene ID 633
Calculated MW 41kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPET
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents